PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034849t1
Common NameTCM_034849
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 280aa    MW: 32103.8 Da    PI: 5.3334
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034849t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1857110356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  Thecc1EG034849t1  57 KKRRLSIDQVKALEKNFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWK 110
                       5568999**********************************************9 PP

2HD-ZIP_I/II128.72.5e-4156148193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlEkdy+ Lk++ydalk + ++Leke+e+L+ +lke
  Thecc1EG034849t1  56 EKKRRLSIDQVKALEKNFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLEKDYAILKARYDALKLDYSNLEKEKEALTVKLKE 148
                       69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-1940114IPR009057Homeodomain-like
PROSITE profilePS5007117.73452112IPR001356Homeobox domain
SMARTSM003891.1E-1755116IPR001356Homeobox domain
PfamPF000467.4E-1657110IPR001356Homeobox domain
CDDcd000862.47E-1557113No hitNo description
Gene3DG3DSA:1.10.10.602.0E-1959118IPR009057Homeodomain-like
PRINTSPR000317.6E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000317.6E-692108IPR000047Helix-turn-helix motif
PfamPF021831.3E-13112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MKRLSSSGSL DALISICPPK EEKNSKNKQV YSREFQAMLD SLDEDDNLEE AGQATEKKRR  60
LSIDQVKALE KNFEVENKLE PERKVKLAEE LGLQPRQVAI WFQNRRARWK TKQLEKDYAI  120
LKARYDALKL DYSNLEKEKE ALTVKLKELK AKLKEENSES SHSVKEDSPN FSQQAKDHDL  180
CDNNDDSNRI VKEESNVNAQ LLISPASSSS FQFNGSSSSS DSSNHQSRFQ PFDSRVILGN  240
MYHPQLVKVE EQCMFTAEEF CNFFSVDQAP TLQWYFTGQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018702.10.0Homeobox protein 6, putative
TrEMBLA0A061FGS50.0A0A061FGS5_THECC; Homeobox protein 6, putative
STRINGVIT_18s0001g06430.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.16e-50homeobox protein 6
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]